PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00956.1.g00190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family NAC
Protein Properties Length: 870aa    MW: 95380.9 Da    PI: 9.3607
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00956.1.g00190.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like31.53.9e-10127150225
                       G2-like   2 prlrWtpeLHerFveaveqLGGse 25 
                                   pr+rWt+ LH++Fv+ave LGG+e
  Zmw_sc00956.1.g00190.1.am.mk 127 PRMRWTTALHAHFVHAVELLGGHE 150
                                   8*********************97 PP

2NAM175.21.8e-545676921128
                           NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksg 81 
                                   lppGfrFhPtdeelv++yL++kv++  + + ++i++vd++k+ePw+Lp+k++ +ekewyfFs rd+ky+tg r+nrat+sg
  Zmw_sc00956.1.g00190.1.am.mk 567 LPPGFRFHPTDEELVTYYLTHKVSDFAFAT-RAIADVDLNKCEPWELPSKASMGEKEWYFFSMRDRKYPTGIRTNRATDSG 646
                                   79*************************999.88***************999999*************************** PP

                           NAM  82 yWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                                   yWk+tgkdke+++  g lvg+kktLvfy+grapkg kt+Wvmheyrl
  Zmw_sc00956.1.g00190.1.am.mk 647 YWKTTGKDKEIFH-CGMLVGMKKTLVFYRGRAPKGGKTSWVMHEYRL 692
                                   *************.99*****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.8E-7124151IPR009057Homeodomain-like
SuperFamilySSF1019416.28E-63561713IPR003441NAC domain
PROSITE profilePS5100559.423567713IPR003441NAC domain
PfamPF023653.5E-28568692IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 870 aa     Download sequence    Send to blast
MPFLTHAHKL ASYKNRMSYG THDLITKIPS YSISLNKNKL NSLLLRGEPC HETGLNDEPN  60
LCLGLDSTAT DMAHQDTVHC DIQQKRLHQP DQIQRFKKSS SGSQTLSGGA VRSGNGSGGG  120
KRSSRAPRMR WTTALHAHFV HAVELLGGHE SHAEMRDMGF LRRGCEVYGF DAFNYHTSNP  180
TVSARRSRDR AIYHCCAQGR GRVSNDSALL LATEIIMCGK THQSSSSALA GRPLKYTAVL  240
VLPRWWRFGS ASGTTTATMT PGGAVREAPS WCARPPFSQQ APLPLPCPYL MSSHRSRYLL  300
AQNHQIQGWK RGPPAQHGTA AHSAGHVETG NSITRPPSWS YSGIASRWSC PTMATTKGSG  360
GAEEQAAQRM KQQVSSSSSM PSLEISLGRQ GWQQDQPQPQ QRGKELTLLK CLVKLGHNVH  420
ECCEDLRMLP SSGRSELSIG SPLTGFWSNN EDSATRRWME LAGNPSLHRG VNVKRRIDAS  480
SSILSTSPSP SPVTLAVVFG PRLVRPREPA LEDEEDRPEG GRTCGEGRIN SVCSSATIYA  540
PLPERLSPPL PRAGRALRPR VVMEEGLPPG FRFHPTDEEL VTYYLTHKVS DFAFATRAIA  600
DVDLNKCEPW ELPSKASMGE KEWYFFSMRD RKYPTGIRTN RATDSGYWKT TGKDKEIFHC  660
GMLVGMKKTL VFYRGRAPKG GKTSWVMHEY RLQNKFPYKP NKEEWVVCRV FKKCQIIKVR  720
PPTDSPTMDS PYHDGNASLG ELDVSSILSN LTPASVHTSS SAPGEGFGHR VDMNAYMSWM  780
AAANQGAAAA AMIPWAMAPG LLGNVFAAPN QPYAGCSPSQ PREIGGVVAN VGGGQAMFGS  840
SVAKVDMECD QQHQPPPQQL GIDDSTWGAF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A6e-5356771320168NAC domain-containing protein 19
3swm_B6e-5356771320168NAC domain-containing protein 19
3swm_C6e-5356771320168NAC domain-containing protein 19
3swm_D6e-5356771320168NAC domain-containing protein 19
3swp_A6e-5356771320168NAC domain-containing protein 19
3swp_B6e-5356771320168NAC domain-containing protein 19
3swp_C6e-5356771320168NAC domain-containing protein 19
3swp_D6e-5356771320168NAC domain-containing protein 19
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450